PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10038623
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 840aa    MW: 92897.5 Da    PI: 5.466
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10038623genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.34.9e-103764128
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIa 28
                     rg WT+eEde+l +avk + g++Wk+Ia
      Lus10038623 37 RGQWTAEEDEILCQAVKHFKGKNWKKIA 64
                     89*************************8 PP

2Myb_DNA-binding62.11.1e-19109155148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W+++Ede+++ +v+++G+  W++Ia++++ gR +kqc++rw+++l
      Lus10038623 109 KGPWSEQEDEIIIALVHKYGSTKWSAIAQHLP-GRIGKQCRERWHNHL 155
                      79******************************.*************97 PP

3Myb_DNA-binding50.16.4e-16161203145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT++E++ l++a++ +G++ W+  ++ ++ gRt++++k++w+
      Lus10038623 161 KEAWTQDEELSLIRAHQIYGNR-WAELSKFLP-GRTDNSIKNHWN 203
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512941032103IPR017930Myb domain
SMARTSM007173.3E-736105IPR001005SANT/Myb domain
PfamPF002494.1E-73764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-1738111IPR009057Homeodomain-like
SuperFamilySSF466891.51E-1038113IPR009057Homeodomain-like
CDDcd001671.23E-940103No hitNo description
PROSITE profilePS5129431.436104159IPR017930Myb domain
SuperFamilySSF466891.2E-30106202IPR009057Homeodomain-like
SMARTSM007172.3E-18108157IPR001005SANT/Myb domain
PfamPF002494.7E-19109155IPR001005SANT/Myb domain
CDDcd001672.66E-16111155No hitNo description
Gene3DG3DSA:1.10.10.602.0E-27112158IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-21159210IPR009057Homeodomain-like
PROSITE profilePS5129419.158160210IPR017930Myb domain
SMARTSM007172.1E-15160208IPR001005SANT/Myb domain
PfamPF002492.1E-14161204IPR001005SANT/Myb domain
CDDcd001674.96E-12163203No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 840 aa     Download sequence    Send to blast
MGTDKLVSTP SDGVSNGAQK SRPHQGRTTG PTRRSTRGQW TAEEDEILCQ AVKHFKGKNW  60
KKIAWPERIL TEYCSSVIAI LSSAECFKDR TDVQCLHRWQ KVLNPELVKG PWSEQEDEII  120
IALVHKYGST KWSAIAQHLP GRIGKQCRER WHNHLNPSIN KEAWTQDEEL SLIRAHQIYG  180
NRWAELSKFL PGRTDNSIKN HWNSSVKKKL ESYFASGLLD QVQGFPPVVN QNQSTPSSSL  240
RLQNSGDDSY SSRKCGTEAE EISECSQESN VMACSQSASD LGNSIVNSRE EVHLPQDSRL  300
GKEQHYCSEQ YNTSLGNVPF SNPEVPCQAG CSSNFLLQNY PHMSASAAYE LNSEGPSNMH  360
PMELGEGFSG AHCIAAHESQ EVANVSLPDS MGFSAPVCLE DMGADLQDTG SLCYEPPRFP  420
ILDLPFLNCD LVQPDSHLQQ VYSPLGLRQF LMSSSNCISP FRLCDSPTLS TSPDAVLKSA  480
AKSFTCTPSI LKKRTRDLLS PLSETRKDKR LGTGIASTLA KECQSLDAMF DETETDVISL  540
MSNKKSKHAP WFEDKENLDP SLLDGKEKRQ ELFIVPEDSD NCDNTQKNVD NEINCSRPNI  600
KDHPGVGYQI PSRVVDDESS NDLSLYSPDP QTRRSLVASS EKVVPSGNPN TVTATELTSV  660
PPLTTEENTV ANTWNDTAVE NYSIFGGTPY KRSIESPSAW KSPWFINSFI DGQMIDKDIP  720
VQDIGYHYDA LSLLKQFSEQ TAAACANAME VLRDETPQST RKGRGKKSLS SDQDECYNGS  780
HLANITSKGR VLEFSECGTP EKGIMEKVKC YNTTTTTSGA VSTLSTPPSS SSYLLRSFR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-60372106159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-60372106159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006450634.11e-160hypothetical protein CICLE_v10007316mg
SwissprotQ9S7G71e-119MB3R1_ARATH; Myb-related protein 3R-1
STRINGPOPTR_0006s25840.11e-152(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-110Homeodomain-like protein